PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009615641.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 295aa    MW: 33751.8 Da    PI: 6.5952
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009615641.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEdellv++++  G g+Wk+ +++ g+ R++k+c++rw +yl
   XP_009615641.1 14 KGKWTAEEDELLVNYIQANGEGSWKSLPKKAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding59.85.8e-1967111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEde +v+++  lG++ W++Ia++++ gRt++++k++w++ 
   XP_009615641.1  67 RGKFTAEEDETIVKLHSSLGNR-WSLIANHLP-GRTDNEIKNYWNTN 111
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.024961IPR017930Myb domain
SuperFamilySSF466891.14E-3011108IPR009057Homeodomain-like
SMARTSM007171.7E-131363IPR001005SANT/Myb domain
PfamPF002499.5E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-231568IPR009057Homeodomain-like
CDDcd001676.59E-91661No hitNo description
PROSITE profilePS5129428.37962116IPR017930Myb domain
SMARTSM007175.2E-1866114IPR001005SANT/Myb domain
PfamPF002494.8E-1767112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-2769116IPR009057Homeodomain-like
CDDcd001671.41E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MVRAPCCEKV GLKKGKWTAE EDELLVNYIQ ANGEGSWKSL PKKAGLLRCG KSCRLRWTNY  60
LRPDLKRGKF TAEEDETIVK LHSSLGNRWS LIANHLPGRT DNEIKNYWNT NLRRRIYTFK  120
LHKKLIRTTA VMPKMAVAVA GDCESSRKHG RVGRSNGKSC KNINSTTSES TGKVKSSCFG  180
GGGTGTMWSE DGSIESLLPE NHIADIGKGL AMQRHEHQAE SEISEPRNEE GEDKNERHIN  240
VTPENDFDNW CDMNFDHFYE EELWVDQCNS LDLEFGSNEE CTYWDDMLLW LWNDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-271211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT9629451e-32KT962945.1 Petunia axillaris x Petunia x hybrida isolate A2-66 transposon dTph12, complete sequence; and MYB-FL gene, partial sequence.
GenBankKT9629461e-32KT962946.1 Petunia axillaris x Petunia x hybrida isolate C2-6 transposon unknown, complete sequence; and MYB-FL gene, partial sequence.
GenBankKT9629491e-32KT962949.1 Petunia axillaris subsp. axillaris R2R3-MYB transcription factor (MYB-FL) gene, complete cds.
GenBankKT9629501e-32KT962950.1 Petunia exserta truncated R2R3-MYB transcription factor (MYB-FL) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009615641.10.0PREDICTED: transcription repressor MYB6-like
SwissprotO222644e-66MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A0S3CVB61e-110A0A0S3CVB6_PETIN; R2R3-MYB transcription factor
STRINGPGSC0003DMT4000602362e-80(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.12e-69myb domain protein 111